DPCstruct | MC8201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 275 ± 70 aa |
| Standard deviation of domain lengths | 70.34 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 81.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 38.59 |
| Pfam Score | 98.99 |
| Assigned Pfam label(s) | CL0016- PF05634 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6QGZ9 | 41-376 | PIPVLELRRRAKERMKAAQGKPKQPLPPPKNGMLVRRLIPVAYKVYNARILLINNLRKLMKVVPVKGCKYCSEIHVGSVGHSFRTCR… |
| A0A834YMQ9 | 510-845 | PTAMKVLIRRAKEERAARKAEPCRILEEAPDNGLLVPQLIEVAHRVYRARESLLLGLSKLVHVAVPVKRCRYCTEVHIGHVGHEIRT… |
| A0A165ZGB7 | 18-306 | None |
| A0A6A6L469 | 17-288 | None |
| A0A4S4EQG7 | 331-669 | None |
| A0A835J433 | 4-171 | None |
| A0A5D3D1K7 | 444-782 | None |
| A0A2N9IJG3 | 12-417 | None |
| A0A7J0GB43 | 1-201 | None |
| A0A7I4BTD0 | 13-379 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.