DPCstruct | MC8200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 152 ± 22 aa |
| Standard deviation of domain lengths | 22.46 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R3JK68 | 4-161 | VRETVKAYYAKLPESQKHEATKFFNSLDKDGDGKITVEEFMGWVKQKGFKSLNRYESIFKELDKHKNGTLDFDEVLMLFYLYKSGRF… |
| A0A834YHR9 | 4-153 | MCEAALAYYEAGSEELKQLAREFFCSMDIDGDGRISYWEFMEFLRQRGHEVNKYHSFMALDTDRNDYLDFNEVLVYYYVVKAGRRTC… |
| A0A7N2MK41 | 2-119 | None |
| A0A7N2MM88 | 156-298 | None |
| A0A4Y1RMI2 | 180-362 | None |
| A0A1R3G6Z5 | 46-213 | None |
| A0A6A6MM28 | 5-162 | None |
| A0A5J5AA28 | 2-153 | None |
| A0A2H5P2M7 | 2-149 | None |
| A0A822XPX7 | 3-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.