DPCstruct | MC8198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 124 ± 10 aa |
| Standard deviation of domain lengths | 9.51 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834YH28 | 1-118 | MQTLDARHIELFLNEGYKNGSWEYKDIGSQEIKKHTDGATGGIFDIRHLKDPCTSEIFDLKSWIGKADDWQPKARITLHAVAVNTNL… |
| A0A2K1KEV1 | 255-379 | LASCEGTMQTLDARHWELFLNKEYKDREWKYEQVCMRVVAGHCSEAAACIFDAKQLRSKGTHGLLNLSSWNAPPGQWQPKGITSSHG… |
| B9SBI5 | 107-240 | None |
| A0A1S4A1L6 | 53-189 | None |
| A0A453EFK7 | 23-141 | None |
| A0A2U1PSS6 | 185-297 | None |
| A0A1D6QHT3 | 221-333 | None |
| A0A4S8IXA7 | 445-582 | None |
| K4AL60 | 37-159 | None |
| A0A7J0EUT3 | 123-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.