DPCstruct | MC8197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 75 ± 4 aa |
| Standard deviation of domain lengths | 4.17 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 59.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E5V8H7 | 29-101 | MERSKSFVKALQELKNLRPQLYSASEYCEKSYLHSEQKQMVLDNLKDYAVRALVNAVDHLGTVAYKLTDLYEQ |
| A0A834Y7C5 | 1-73 | MQQSLLFSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQIVVDTLKEYAIKALVNTVDHLGSLTYKVKASLDE |
| A0A7J8WU63 | 92-164 | None |
| A0A0B0MTW9 | 46-118 | None |
| A0A7J7L0S1 | 21-93 | None |
| A0A835J3K3 | 16-95 | None |
| A0A0D2RDX1 | 24-96 | None |
| A0A4S8JUL2 | 124-196 | None |
| A0A835D5P8 | 207-279 | None |
| C4J077 | 147-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.