DPCstruct | MC8196
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 185 ± 36 aa |
| Standard deviation of domain lengths | 35.89 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T6XSR3 | 2-144 | NEDDLRIDDLDGHIERCYERIAENIMPQVFEQRLKNYTAAKLKLDQMRFPGSEELSWDAIQRVHSLDAIKADLVCYTDEREQLPNVE… |
| A0A1F5LYX0 | 215-416 | PGNRIPSHQIFESHNSNPTSDIRYQSNMPIETKSRRRRWIHTGDPITNIADVPEGWSSYEPDLHKDDVDGQIARCRERIRDAIMPDI… |
| A0A0A2JZ57 | 16-227 | None |
| A0A1V6XZC6 | 6-224 | None |
| A0A1V6Y9H2 | 42-189 | None |
| A0A3N4IKZ1 | 1-155 | None |
| A0A3N4IEE6 | 126-290 | None |
| A0A1V6TYA2 | 13-200 | None |
| A0A1V6TD83 | 18-240 | None |
| K9G072 | 35-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.