DPCstruct | MC8192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 142 ± 13 aa |
| Standard deviation of domain lengths | 13.32 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 27.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C9I4B0 | 2-110 | TVFILLACLGGVLVGLSRQLNGRLSISTTPLIASFWNHVIGFAALTCLGLFVGGLLPAGAAEAPWYAYLGGSIGVVFVAAGSWVIAR… |
| A0A835SYC6 | 8-159 | VGCACAGLAGALLATQSGVNSTLGAAVGKSFAAVVSFAVGLGALLVFFAIDTAALGHKGPTPEGAAAAPWWTWVGGFLGAWYVAVVI… |
| A0A2G2LT74 | 6-127 | None |
| A0A411T126 | 7-152 | None |
| A0A517SZK9 | 23-180 | None |
| A0A7U9IYX8 | 10-155 | None |
| A0A3N8E0R8 | 2-144 | None |
| A0A0M3GER9 | 200-345 | None |
| A0A485D3B4 | 265-404 | None |
| A0A7C2UU57 | 59-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.