DPCstruct | MC8190
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 424 ± 41 aa |
| Standard deviation of domain lengths | 41.45 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M3Q0G6 | 7-424 | FMVAAAVRPDREQDLRALLEAMNLEPGQVDPANPMLPFARYDRLHVARFVILRDDTLGDLAAYDTALPDAPVWLVFLGDCDGAGDDM… |
| A0A2N2TDE5 | 2-485 | HCVLTPGWTGDTQTLPALKGGLDALFDSLGFVHFASIALLPMRPGEPDTALPSLMLELAIDEGMQTPLLLELLVARGLEALWPLYGA… |
| A0A843T695 | 66-495 | None |
| A0A1F3A3T1 | 58-469 | None |
| A0A7V8VUP1 | 86-553 | None |
| A0A7W7A8L5 | 3-487 | None |
| A0A4Q3A957 | 3-412 | None |
| A0A1I3KKP1 | 155-560 | None |
| A0A5C6XL38 | 259-699 | None |
| A0A848LNX1 | 2-480 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.