DPCstruct | MC819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 220 ± 16 aa |
| Standard deviation of domain lengths | 16.49 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3VNU7 | 8-218 | WQRLQLNSVQVVTHLQQFKEQVEAQPQAWCKGTGPSDPAPTGLAYQLLNAGELLALCAGHRGMVMVQLYVGWGGKGGAPPPQPVFNP… |
| A0A150GWM2 | 43-263 | GLHGAVVLRCERVGGLAELRSQAAVQPGVWCAGTGPSDPQPSDEDRALYTAGELACLLEGQRGVVLLQLHVGWDDHDAIPPYGPYKP… |
| A0A835YAR5 | 122-352 | None |
| A0A2J7ZJQ7 | 302-516 | None |
| A0A383W3C0 | 115-342 | None |
| A0A0D2LZP8 | 1-217 | None |
| A0A2V0NUU9 | 202-457 | None |
| A0A2P6THS6 | 566-760 | None |
| A0A7S0T2W0 | 203-397 | None |
| A0A2P6V5J8 | 97-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.