DPCstruct | MC8189
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 56 ± 4 aa |
| Standard deviation of domain lengths | 4.33 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 70.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0304 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7XMS2 | 1-48 | MTLYLDDERETPARWIRVLWPVEAIAWLKTGDVTEISLDHDLGDDNRG |
| G3A2B7 | 26-83 | MKVFLDDERETPDGWQRVYWPEEAIQLLETGSVEEISLDHDLGDDAHGTGYDVILWIE |
| A0A810YKS2 | 32-89 | None |
| A0A239JDA3 | 1-58 | None |
| A0A167NH39 | 1-48 | None |
| A0A5C5XTT7 | 1-58 | None |
| I1YIH1 | 1-58 | None |
| A0A4R6YQN1 | 13-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.