DPCstruct | MC8187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 143 ± 10 aa |
| Standard deviation of domain lengths | 9.75 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z9C872 | 1-128 | MIADGILSKIIRHKGDVYKVVNHGEKTQSYLVTDGVNYAHGKTLKEARDSLVYKISDRDKSAYKGKTPGDVMSKAEIIKMYRVVTGA… |
| A0A5S9RH63 | 7-163 | TLKFGKHKLKVKCVDKIPFIIEREKTTKGIRIYTGFNFKGPDENGSLKNETIYVAEKGNFFAHGSTVKLAISDVQFKIVAEKLKNNP… |
| A0A4S4A4H9 | 292-429 | None |
| A0A6B3LHX3 | 174-311 | None |
| A0A235EVC9 | 277-444 | None |
| A0A494GKA1 | 133-266 | None |
| A0A497SGN1 | 269-406 | None |
| A0A378RMV5 | 401-538 | None |
| A0A4S4A403 | 685-831 | None |
| A0A642MC07 | 6-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.