DPCstruct | MC8186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 156 ± 35 aa |
| Standard deviation of domain lengths | 34.66 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 81.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 28.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838WIL8 | 1-155 | YKLKVKRPGSDESREVNVDLIETFNWLVGLTVQSIAAPQTFTAEFERDTEGRLTIKGRLRQVAASPWWFRTVTGTTPDGRRALIIWR… |
| A0A1G0NT38 | 2-100 | ETFNYLLGLEIDRIRAYRPKWDQRRLYRAVFGAAEGKTTVVVWRNTDGLGLEADRAFIEKEILKDEQVDMLYINGDSSVPNAHPIEK… |
| A0A806J718 | 123-275 | None |
| A0A7T9E6N1 | 367-597 | None |
| A0A7X3T6L2 | 127-244 | None |
| A0A5B9D7Q7 | 819-942 | None |
| A0A142LLS5 | 1-150 | None |
| A0A661SK56 | 1-140 | None |
| A0A7Y8ATB1 | 6-181 | None |
| A0A5P9EHN4 | 67-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.