DPCstruct | MC8184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 116 ± 18 aa |
| Standard deviation of domain lengths | 17.84 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.60 |
| Pfam Score | 98.33 |
| Assigned Pfam label(s) | PF08375- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A9P1K7 | 3-81 | LLDMFPPFLLAVPKKKTSHSKKAMRSANKSLKDKQNIVNCPACGSPKLAHNLCSNCYTYLNRTWKSQNKGAGGNAIPDL |
| A0A0D2X5B8 | 86-223 | IAVMAAVAGSLSRRLAQAADRMLASLYLIPAAAEEQGRGPHRLDFALAASSESPLAAEEHERSSLTESVMDVLREGFLWALPKRKTT… |
| A0A369RUV4 | 3-121 | None |
| A0A2A6CDC8 | 36-168 | None |
| A0A5N6FJA0 | 1-140 | None |
| A0A1E5RZW3 | 70-194 | None |
| A0A1V8SUD7 | 1-79 | None |
| A0A3N4IB30 | 4-116 | None |
| A0A1V9YHF3 | 2-106 | None |
| A0A1B6L2F5 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.