DPCstruct | MC8183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 109 ± 18 aa |
| Standard deviation of domain lengths | 17.70 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05303 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2X062 | 11-112 | DRDIQLIVEANDIVKDAANHVTSIAVSSPATDDLVTLVLTTLEQRDCRIELTVDGLKIISMSGPADKAVGSTFESIQALLSCISPKF… |
| A0A0C2CA11 | 11-104 | AIRNLGISPFNPPPGHRKMKGDVLYLFVDTVEKRRLHITCCTKGFFVNSSTDELFNPAPSNQNKAICHSLVDLLNVVSPGFKKAYPT… |
| A0A4Y7U237 | 30-131 | None |
| A0A177ATZ8 | 5-144 | None |
| A0A6V7W9Q1 | 147-255 | None |
| A0A482VP26 | 8-108 | None |
| A0A287A787 | 169-278 | None |
| A0A507FKU3 | 26-151 | None |
| A0A183TC59 | 1-92 | None |
| A0A0N4ZCT4 | 118-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.