DPCstruct | MC8182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 170 ± 33 aa |
| Standard deviation of domain lengths | 33.34 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.72 |
| Pfam Score | 98.44 |
| Assigned Pfam label(s) | CL0124- PF09420 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3TKX4 | 8-154 | SFDYRKDRRKERKKSKKEIIVQNEIIKKSWDKSLSAPANFKRIGLTYDPNEDIYKSDSEVEEGFIRETKTVRELKNAKASKKIREKF… |
| A0A0D2WXX5 | 9-186 | KKHYTVRAAVSSSKVKHRTARNLRKVSVLHPDVQAAWDKNKTLKENFASLGLVVDPNATLQLRAEANLAASRGLLSNGDAPGSVDLL… |
| Q2HBH0 | 1-180 | None |
| A0A084RNH9 | 1-214 | None |
| A0A0P1AUU3 | 4-163 | None |
| R9P5J5 | 82-297 | None |
| F4PSD5 | 452-606 | None |
| A0A0N5CU35 | 10-142 | None |
| A0A7R9WS66 | 2-152 | None |
| A0A120E6W5 | 1-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.