DPCstruct | MC8181
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 79 ± 8 aa |
| Standard deviation of domain lengths | 8.46 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 69.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 46.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04418 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H5S8G9 | 1-64 | MGKKSEDELSETFDRCLADTAVKIVSAGSVGLIAAAIFKRQFPLWLGTGMGFGMGIANCRHDMR |
| A0A0D2WWT3 | 9-99 | ESKQQQQIASEAQLGAKWDRCFTNMLVHTGVGAGVGIVLSLIFFKRRMAPVYLSTGFAIGTAYQQCQDDFASARATGKVVRISEAAL… |
| A0A6P8V376 | 2-72 | None |
| A0A194R4C4 | 1-81 | None |
| A0A395IQE1 | 51-121 | None |
| A0A6P7FHV9 | 1-70 | None |
| A0A3P8T4A0 | 109-190 | None |
| F4X8A2 | 1-71 | None |
| J9ELN6 | 5-89 | None |
| A0A427YIJ3 | 6-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.