DPCstruct | MC818
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 100 ± 12 aa |
| Standard deviation of domain lengths | 12.49 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0418 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N0BHH2 | 62-153 | MVLIIHGFPSSTAALRFEWAWQHPHVSRRLKHVPKKKSQQRVFEFCLLVLSEMLKVGPWCRLPLTIRWLDYEFFDKYSSYVSAPMHM… |
| A0A150GV03 | 1-95 | MTLVLYGFPTKIQALQFEWAWQHPLKSVIVKPIAQALGAKKLTGVRGKILLMLSMLHESPWRHFPLTLQYLAPEYAVMVKAEAIRMR… |
| A0A077WTE5 | 55-164 | None |
| A0A484ATF1 | 328-420 | None |
| A0A7J7QLB4 | 44-133 | None |
| A0A0V0UUK5 | 58-153 | None |
| A0A5A7QZ17 | 82-173 | None |
| A0A0G4L0R4 | 191-327 | None |
| A0A5D2WC72 | 54-153 | None |
| A0A2V0PIT6 | 49-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.