DPCstruct | MC8179
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 226 ± 38 aa |
| Standard deviation of domain lengths | 37.50 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6T8PL53 | 95-360 | TKRPYLDDLRPFRAQFQPQQLILSTLRCSLLTVSQNLTGYLSDQLNQDAHYEELVTSGKLTEEEAELAASAKSDGDWDAILETLPRK… |
| A0A0D2WQJ8 | 14-210 | YHFEEYRVPSFVFHRTTLMISSIKATLAVAPLALQRNPDNSPKVNPRAIPSIWARTVLRELCVISTKTCLQRLVLNVCTLQTASHFM… |
| D8S0G5 | 160-411 | None |
| A0A7S1SNB5 | 68-332 | None |
| G4ZT55 | 226-488 | None |
| A0A6S7N3B5 | 185-414 | None |
| A0A0L9VCD7 | 3-187 | None |
| A0A218XLH6 | 65-315 | None |
| A0A165YZ03 | 103-326 | None |
| A0A7S2XZP6 | 22-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.