DPCstruct | MC8178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Standard deviation of domain lengths | 7.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05493 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2WNR5 | 3-73 | AGGIVILIFTIVFLVLGGAGFFFAPKGPNRGLVQTMSILTAFCMWIFWLCTFMSQMNPLIAPIIKTEDIAK |
| A0A7J7KC08 | 2-68 | SIICGVIGLVIPFLVPKGPNRGIIQVMLVTTAVCFYVFWFCCILAQMNPLFGPELNKEAMYIVAQQW |
| A0A2K6UN09 | 6-88 | None |
| A0A4Z1KIS6 | 2-72 | None |
| A0A4Z1NRH7 | 9-78 | None |
| A0A5J4NAQ8 | 7-90 | None |
| A0A3N4LN96 | 1-72 | None |
| A0A044SEK1 | 2-90 | None |
| A0A1B7YJH7 | 70-138 | None |
| A0A5S6Q8Z5 | 2-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.