DPCstruct | MC8176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 148 ± 29 aa |
| Standard deviation of domain lengths | 28.79 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.91 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 42.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03879 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A210Q7V8 | 74-183 | NSIPKGRAKSGRPWKVNRMARSSEIKKVKSLKSSWAEKMKKKAEEQSVKSFEKQLKDERAAKLELQRQRQNEHKQRKLENEKKSEVV… |
| A0A0D2VQW8 | 29-183 | VAAPAPVPVAAPAAPAVAPAETAPAKPRKAKPAIDPRNNAAPNPLDAGVVGKAKSGRHWKTRQTQRASARMNVPSARVGWAKLMERK… |
| A0A1B0A075 | 2-133 | None |
| E9GAI8 | 338-447 | None |
| A0A2D0QGK5 | 2-137 | None |
| A0A814SPT1 | 98-227 | None |
| A0A818HBC2 | 8-125 | None |
| H0Z795 | 263-427 | None |
| A0A3B1JIR2 | 39-218 | None |
| H0VV82 | 135-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.