DPCstruct | MC8175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 164 |
|---|---|
| Mean domain length (aa) | 154 ± 28 aa |
| Standard deviation of domain lengths | 28.10 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 71.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 20.88 |
| Pfam Score | 99.69 |
| Assigned Pfam label(s) | CL0323- PF04145 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4QLB2 | 601-735 | MHMLGFTFTGEETPCLVYLFQGWHLTDSVRFWGAWIVTVLAGIFAEWLVAVRRWEATWRPVPKAAVGRFSPRRIVRQAGRLMLYALT… |
| A0A0D2UDT0 | 1-152 | MTFYWSSSVTILFDEWAPATMGEYFGALVAVFFLGVAYELTRFLAHSLDKSLLAQSARASNDHSVLIEKRHVNGSGSSRVNFGLFDQ… |
| A0A1Q9CJX2 | 14-192 | None |
| A0A1Y2H9U7 | 227-419 | None |
| A0A146HK07 | 50-206 | None |
| W7B0I0 | 130-262 | None |
| A0A7J6KYV4 | 350-491 | None |
| A0A7J6LYW2 | 335-476 | None |
| A0A1E7FY33 | 643-780 | None |
| R1CZ96 | 399-560 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.