DPCstruct | MC8173
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 92 ± 11 aa |
| Standard deviation of domain lengths | 10.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8Z8J9 | 1-82 | MIYFGDGETDIPCMKIVGMFGGNPIAVYDPSSAKKKAYAEKLRRQGRVNFISPAIYTADSRIFKLVRAMIDKIKADDELQQL |
| A0A7C4IH58 | 292-384 | NEHMPENERRIPFSNIIYIGDGLTDVPCMTLVRKSGGYALAVYSTKSTGGLKVCQGLLKSGRVSYIAPADYRKGSTLDKYIKSLLTT… |
| A0A7Z8LB05 | 1-80 | None |
| C6REV3 | 178-272 | None |
| A0A100WEC4 | 105-201 | None |
| H1D9S1 | 32-126 | None |
| C7HB18 | 91-185 | None |
| G9WQ62 | 34-132 | None |
| A0A1W9QEI9 | 2-76 | None |
| A0A6P1AIY1 | 14-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.