DPCstruct | MC8172
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 105 ± 13 aa |
| Standard deviation of domain lengths | 12.66 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 93.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8Z845 | 14-127 | DSYYGYRIHEITEMIVADMGNYAHGNQSIQHMIYLYNYVGAREKTDRHIAEVRERLYSSAPDGYPGDEDNGQTSAWYVLSALGFYPV… |
| A0A5M5DX79 | 604-711 | GRIGAYWHGNEPCHHVAYLYNYLKEPWKCQKWVRTIVDRFYGDTPDALSGNDDCGQMSAWYMFNCIGFYPVAPSSNMYNIGSPCVEA… |
| A0A812M016 | 170-291 | None |
| A0A066VAS3 | 112-222 | None |
| A0A127Z6N7 | 362-462 | None |
| A9WTL6 | 195-285 | None |
| A0A1M5EPK2 | 573-685 | None |
| A0A538Q9E4 | 289-385 | None |
| H0EZP5 | 129-210 | None |
| A0A834RNR3 | 184-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.