DPCstruct | MC8171
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Standard deviation of domain lengths | 12.02 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7Z9Y5 | 1-94 | QNELFVFPNKKTGFDPSEIDLLDPANKALISPNLFRVQKIATKDYFFRHHLETSVDNLSGTKNFFWKREGLKGIDGIVKVRTNHLGD… |
| A0A2M8AIL8 | 57-145 | LHINDMFLLGLREEEIIWENPDYEILKEHLYRIQKLSSKFYEFRLNTEASIQNNFHPFYVRIQSFGEGKTGWDTFNPIKVKISVSGK… |
| A0A7X9PXM7 | 149-243 | None |
| A0A7V4EXS2 | 685-776 | None |
| A0A0S3UL06 | 364-488 | None |
| A0A3N9MTW2 | 167-256 | None |
| A0A4Q3G0R9 | 228-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.