DPCstruct | MC8170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 198 ± 10 aa |
| Standard deviation of domain lengths | 9.59 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7UTV6 | 1-203 | MNIQWTSWAGKYFSNLNINQKCGPPEWMKNLYESQHMGVWPTDKGGIVLLNNDGLIELLIEDEHLNSITPTIITQPEGIAKYGVCES… |
| A0A2T0BCS9 | 178-370 | LKSNDWIGRYFSDLSETNIEITSWMKENYAMEYGLKWSFKGAGIVLVNSKSEIIVLRKGVELGKELNKVIFTDNAQEEFKVKNKLNY… |
| A0A7X9PMN8 | 1-173 | None |
| A0A6L3ZGE8 | 191-394 | None |
| D5DCH9 | 172-364 | None |
| A0A353FFE8 | 175-379 | None |
| A0A2D5QN60 | 251-457 | None |
| A0A1H8REQ2 | 181-379 | None |
| A0A7X9YLS0 | 175-374 | None |
| A0A7H0VAT0 | 182-386 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.