DPCstruct | MC817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 119 ± 17 aa |
| Standard deviation of domain lengths | 16.94 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 45.66 |
| Pfam Score | 98.44 |
| Assigned Pfam label(s) | PF17184- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6PLM0 | 4-100 | VSSIHEDSIFVSEIAQLWPELPLVANMRCGLWYAKKFHSSCYFKSTDGHTNNLSFNTSRLNLHVATLAGQRGGCMIVDSTRKGKRFP… |
| A0A150GRW2 | 6-117 | SPTHESIWKVTRQLKKEQSSLYNCVASVLSDAAFVMEIQALYPGTPLLANLRCGLWYTRCPDGTCYFKSTDGHNGNWSFSCTRLNWN… |
| A0A1L0DZ99 | 6-107 | None |
| A0A2A9P620 | 3-106 | None |
| A0A287X8I7 | 29-137 | None |
| A0A5N6PJ85 | 1-114 | None |
| A0A453SEA4 | 1-90 | None |
| C1MXV9 | 1-144 | None |
| A0A0G4KDG1 | 16-150 | None |
| A0A5J4UUM3 | 6-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.