DPCstruct | MC8169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 300 ± 13 aa |
| Standard deviation of domain lengths | 12.83 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 79.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 18.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U2QA37 | 3-287 | KEIKDNWYVVLGLDFYPIAEENEEIIKNRIEEKKSEWERRKVRAYNKENFIRYINSYDTIKEEMLGSNNIRKELIEDAIAPVDNALK… |
| A0A3D6B4Z2 | 1-301 | MADIKYNYYGMLGLSVETFEGDSKKLAEIAEKKIKEWQGNINIDIQNKAYVHGGKIRETIGNRNIWKNLYYKYREHIVNEISSEIIF… |
| A0A7I8EJ24 | 1-296 | None |
| A0A510JKY5 | 1-298 | None |
| D9SVB1 | 1-287 | None |
| A0A3R5R1J0 | 1-303 | None |
| A0A355W502 | 106-439 | None |
| A0A401Z9H2 | 1-295 | None |
| R5KBL1 | 1-304 | None |
| A6C7U3 | 1-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.