DPCstruct | MC8167
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 126 ± 17 aa |
| Standard deviation of domain lengths | 16.63 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07963 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C1QWX1 | 15-130 | QKGFTLVELSIVLVIIGFLIAGVSAGNNLIRQAQLRSVITDFQQYATTYNNFLTKYSKVPGDMDTAYYLWNTNCAASSAICVGNNNG… |
| A0A2H0QYQ5 | 4-114 | CKSERPKSEKGFTLIELSIVIVIIGLIVAGVIGGQALVEQAKIRSQISEFQKYSVAYNTFKIEYNAILGDFNRASQYWTGAFDGDGN… |
| A0A357FXM4 | 8-136 | None |
| A0A6M8VT98 | 4-141 | None |
| A0A227JLE4 | 15-151 | None |
| A0A3Q8T498 | 1-141 | None |
| A0A0F5MPP0 | 1-102 | None |
| A0A0F5MN89 | 1-102 | None |
| A0A0F5MMR6 | 76-188 | None |
| A0A832A312 | 61-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.