DPCstruct | MC8164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 116 ± 16 aa |
| Standard deviation of domain lengths | 15.93 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 31.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W6FIN5 | 1-100 | MTEELIAKVSPVNPAEVFRTASTCATNNCQHFDGKDCGLVTRIVAQFPIALEELPPCSIRRDCRWWQQEGKAACMRCPQVITDNYNA… |
| A0A5S4FY43 | 2-100 | KADGTLGYLSPVLPVDRGFVARAEEGRAPDARFRFAEPCIRGGCGYWTGSACSLIDSLLEETTDGEDRLPRCGIRRACRWFHQRGPQ… |
| A0A7W8EK98 | 21-148 | None |
| A0A0P4RDX9 | 2-129 | None |
| A0A421BBH4 | 2-145 | None |
| A0A4S2VM53 | 24-168 | None |
| J7Q4Z9 | 32-134 | None |
| A0A4R5QG31 | 52-159 | None |
| A0A2S6N9B7 | 8-110 | None |
| A0A2Z4V2W0 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.