DPCstruct | MC8163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 163 ± 18 aa |
| Standard deviation of domain lengths | 18.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I7A533 | 87-247 | ERAVAVKNVELQDEIYGLKARIAELESRTVKLPPELYTIGELIRTQDNRITDQPMFVVFQKREIIGSDEHSPSRICWVWDGEEVSEL… |
| K0IV80 | 2-173 | KDDIQFLKDLQQELTTQENDGQAAPRFWAIMDYKWEVTEEGHHDRVSLYSPETCGYKTVDEYIDEILNGDRRDEFNDEQIEELQDIK… |
| A0A4S2PZ94 | 5-140 | None |
| A0A662REK1 | 105-246 | None |
| A0A7X1DFR4 | 28-177 | None |
| A0A837WTZ3 | 50-243 | None |
| L9LYX8 | 8-170 | None |
| A0A7Y0Q5F8 | 6-178 | None |
| A0A1T4UJ90 | 17-189 | None |
| A0A2G8BZU3 | 15-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.