DPCstruct | MC8161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 201 ± 23 aa |
| Standard deviation of domain lengths | 23.34 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4A780 | 10-203 | RPKRTDTSLLAQFFYADEDLNLVAAELDSFDGRKDPERCSLLVNQLRTCQDRVLNIIQQIMEDAIPLQRASRDFRVKFPDDVIQENL… |
| A0A340YHZ8 | 37-257 | ADLGDMGHGHPGTPGLRGDRSVVETRRRVWRSDPQLLAQFYHADEELSQVAAELDSLDGRKDPQRCTLLVSQFRSCQDNVLNIINQI… |
| A0A452CA63 | 1-207 | None |
| A0A671EMS5 | 13-204 | None |
| A0A0A9XAD5 | 16-211 | None |
| A0A238C5T3 | 57-234 | None |
| A0A146MEV2 | 16-211 | None |
| E0VTV8 | 10-210 | None |
| A0A1Y3NBJ2 | 4-184 | None |
| A0A0L0G3F0 | 18-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.