DPCstruct | MC8160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 97 ± 16 aa |
| Standard deviation of domain lengths | 16.34 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S5ABH2 | 7-92 | FVMQNKHAKSCGEPPLITNDDSKYYGYFENEHGEQWVFIYDRRTGTAELRGGDVGWERVFLVRNGQVNGLILNENEKMWLQACWKA |
| A0A4P6U227 | 1-106 | MAGVVFDRSDHVLHWVNEFDEQLIFWQRPGESHATLLHSDLDWDPIPITTSGLLLPGAWAQRLDFGEGFPEELRRNSPIPVISGVTL… |
| A0A4R4LPT9 | 144-248 | None |
| A0A7C7R296 | 27-97 | None |
| B4V8Z6 | 103-217 | None |
| A0A5J6EPJ1 | 157-267 | None |
| A0A223S0P3 | 2-92 | None |
| A0A7H8LT36 | 11-101 | None |
| A0A1H9TQA7 | 10-113 | None |
| A0A7G1P2B7 | 1-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.