DPCstruct | MC816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Standard deviation of domain lengths | 6.74 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 50.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150GRM7 | 12-90 | VALLAIFVSSFKPVAAGPLAYGICQTGCNAMVVACYSAAGFTFGTVTAGTGIPAAIAACNAALGTCMAACVAAGCTPTP |
| A0A2D4CJ29 | 10-89 | YKRVTPMLLLLLFLAAMAIAAHYAAPPLLFASCMASCSAAVVHCYEDFGLVFGTISASADDPVAVHGCNALFGAYQTKCA |
| A0A146H417 | 81-151 | None |
| A0A0J9VZT3 | 3-69 | None |
| A0A814QM63 | 1-67 | None |
| A0A0C9X4N7 | 466-532 | None |
| A0A662WWU6 | 625-693 | None |
| A0A4R8QPN9 | 5-82 | None |
| A0A2P6N610 | 43-127 | None |
| A0A164TMY4 | 2-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.