DPCstruct | MC8158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 108 ± 12 aa |
| Standard deviation of domain lengths | 12.23 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19692 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G6ZSK8 | 77-181 | EAEWQHLLKEADEVDWPEYRALVEAAYAEPALRGLYPFTSHWTLRFSTSTRPRLTVIPLCLDAHRDSRYTLSASIMGEVLVDTTTVA… |
| D9W4W2 | 137-239 | EFEWGVIRKLSPELIDQKMVEAAYVTPELRALFPMPAHGSLQFRRRTISAPGSDIPSIFPAAGGCWTVISLHDPQIPRPTVSSAEEA… |
| A0A2Z5JHP5 | 15-131 | None |
| A0A7W9UPR3 | 94-201 | None |
| A0A6G4V4B3 | 2-114 | None |
| A0A0K9XCF6 | 3-87 | None |
| A0A066YLM1 | 127-245 | None |
| A0A1H7G4M4 | 8-96 | None |
| A0A1H8A1Y4 | 5-133 | None |
| A0A1C6S983 | 12-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.