DPCstruct | MC8155
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 168 ± 9 aa |
| Standard deviation of domain lengths | 9.32 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 56.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q5EQP0 | 356-519 | AALAVLRRDGLLDEAADLFHTLWSASSAALPALLAALEQSGQSADGQTLLWERASAPAEELAELAQHLKSAGRTDDVRHLLRQAAGR… |
| D9VPG5 | 28-196 | GFTAELLALRAQGRSGEAHALLCEAAAWPAAELPALAAELGRAGLAADWASLLWEAASLPPDRLAAAAAALGAAGREADCDGLLRQG… |
| A0A2L0N8B4 | 60-224 | None |
| A0A4D4KDR7 | 59-224 | None |
| A0A1Q5KDX7 | 246-415 | None |
| A0A6G9GU88 | 485-655 | None |
| A0A229H5A4 | 683-849 | None |
| A0A0X3XEE7 | 290-486 | None |
| A0A7Y8X2T5 | 4-171 | None |
| A0A3R9X0Y8 | 591-756 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.