DPCstruct | MC8154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 173 ± 19 aa |
| Standard deviation of domain lengths | 18.52 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0198- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D9VM91 | 18-185 | MTPDEALRRIAFLLEWRGASPYRVRAFHTAADAARALEPGPVDAARAGRLRGVGPVTAEVIAQASTGSVPRYLARLEAEAGPEARAG… |
| A0A832DAV1 | 16-153 | VHLRDYAKSIGLKISEYGVFDAKTEKKIAGETEEDVYRAVGMEWIPPELREDRGEIEAALAKKLPKLVELSDIKGDFHCHSNWTDGY… |
| A0A2V5YU03 | 2-180 | None |
| A0A7W1SA87 | 1-182 | None |
| A0A7Y2M5J3 | 434-633 | None |
| A0A535EY85 | 69-258 | None |
| A0A7W1EP50 | 26-186 | None |
| B7BFD5 | 102-240 | None |
| A0A4R1W811 | 167-357 | None |
| A0A2V8GQA0 | 5-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.