DPCstruct | MC8153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 90 |
|---|---|
| Mean domain length (aa) | 151 ± 31 aa |
| Standard deviation of domain lengths | 30.52 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.16 |
| Pfam Score | 98.15 |
| Assigned Pfam label(s) | CL0492- CL0509 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6BEL4 | 48-180 | TYTSLDKYSRFYYYFREKQRAKYHYRLKDYQLCTFSRKCCKTKKVKSFALDKLLNSRLDVVLFYLGISPTMKAARQLINHRHISING… |
| A0A4Q5ND87 | 29-176 | PPGQHGQQRLKFSEFALQLREKQKTKRYYGVYEKQFALYFEKADRSKGVTGTELLVLLETRLDNVVYSLGFASSRREGRHLVKHNHF… |
| J7KEH5 | 70-224 | None |
| A0A6C0UA65 | 209-417 | None |
| A0A5B9IKV3 | 76-190 | None |
| A0A2E7E257 | 17-172 | None |
| A0A0H4T6G4 | 102-244 | None |
| A0A5N5J0B3 | 107-235 | None |
| A0A5A7R379 | 125-251 | None |
| A0A0E0R1N0 | 11-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.