DPCstruct | MC8152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 76 ± 6 aa |
| Standard deviation of domain lengths | 5.89 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 40.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K4IBL6 | 112-183 | EWSVLAAPGQIKPGDFLSFTVGGKPLCVKAKDVLFAGTDREEVIYRRRRNQYFITAMVVAGTSSHKGVLVRS |
| A0A443XMN9 | 77-149 | KTMQLTAEGQLAKGDKIKIVGKSESDSQTITVKEVIDVDGHEEVIINKRKNRYFITNMVLDGTSWAKSVTKIS |
| A0A1S1GPR7 | 55-133 | None |
| A0A2W7P1M6 | 32-120 | None |
| A0A839A2Y8 | 3-71 | None |
| A0A2N5C415 | 188-258 | None |
| A0A5E6RAF1 | 241-319 | None |
| A0A212BEE0 | 67-136 | None |
| A0A0P7FS67 | 54-129 | None |
| R0CE48 | 146-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.