DPCstruct | MC8151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 260 ± 47 aa |
| Standard deviation of domain lengths | 46.63 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 20.25 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | CL0363- PF09000- CL0446- CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A080J0N9 | 54-246 | KVSAARTVLENGLRGGLPEPSRPAAVPFARLEPASGNEKKIIRLMVTQQLEKVTDIPASQLPAAGNNVPVKYRLTDLMQNGTQYIAI… |
| A0A7D5LT93 | 7-274 | AITVSGQGLIQVGEGAAALAQGIADAIAALGRILVAGPGMYIATFVTLGLYSSPTASASQDRTPDRIRYGFGLKAEQLGLAPGTDLQ… |
| A0A6M1VU75 | 179-522 | None |
| A0A0K0MNM0 | 225-469 | None |
| A0A737NSJ2 | 2-157 | None |
| A0A1R3UQW6 | 406-667 | None |
| A0A7X5BIN1 | 232-406 | None |
| A0A2K4VMT9 | 295-607 | None |
| A0A4U9HBS5 | 90-312 | None |
| B4F067 | 139-369 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.