DPCstruct | MC815
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 113 ± 13 aa |
| Standard deviation of domain lengths | 13.12 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150GQK3 | 1-111 | MAGETPPHSRVWLPELVERFARFLPPNVVACALRLVDKATSAQFRGRPQFATVRLSHPVPPWAFAARWAAPGAMTHLTLAQRHQLLC… |
| A0A150GZZ8 | 45-173 | IPDPSRIWLPELVTRIASFLPPNFVACTMRLIDRATARLLRAHTAVRLSQPSPPHEFARRWGCAAALRPLARQQRRRLLALTAGTGC… |
| A0A150GBI8 | 15-152 | None |
| A0A150GHT8 | 1-111 | None |
| A0A150GJW4 | 1-133 | None |
| A0A2K3E3F0 | 4-113 | None |
| A0A2K3E5Q3 | 45-154 | None |
| A8IP46 | 287-422 | None |
| A8I7H3 | 179-305 | None |
| A0A150GAL2 | 9-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.