DPCstruct | MC8145
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 65 ± 5 aa |
| Standard deviation of domain lengths | 4.52 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 47.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V4ALJ9 | 8-70 | HPSTAGIARFFAYEHLSREDMRAISRQCHDLAESMIRALPDGPELTAGLRKLLEAKDCLVRAA |
| A0A2T3JKD8 | 1-61 | MNILTFFAYEHLPKHLQVVSKPFCDTANHVVDTLPDNEERSVCLRKLLEAKDCAVRAQLGG |
| A0A0F9N0U3 | 11-75 | None |
| A0A085ERU9 | 1-74 | None |
| N9T1T9 | 3-63 | None |
| A0A5C7MQJ2 | 4-66 | None |
| A0A3S0BVE8 | 7-77 | None |
| A0A117E6Q9 | 6-79 | None |
| K0HX36 | 1-67 | None |
| A0A4R2JC75 | 33-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.