DPCstruct | MC8141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 213 ± 14 aa |
| Standard deviation of domain lengths | 14.34 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 21.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A395YED8 | 2-195 | AQWYSEHIYPWIVSLIGRFFGIFPFSVAEFLLYAGILLLVGSLVRIIYRLIKKKADKKEGLRYLRRLGIIALILAALYMTNCGINYH… |
| A0A2V2GIJ0 | 143-357 | FIMLCIGVLAGAVHLVLALSTRFSDFMSVTVSAALRFCLAKLTGVLPFSLAETLIFMLPAVIILLFVISNAYAASKRKWWRFFFSLL… |
| A0A1H5SZA6 | 67-292 | None |
| A0A318N2K2 | 2-222 | None |
| A0A7X6YXJ8 | 1-200 | None |
| A0A2V2G700 | 87-312 | None |
| E6UI57 | 3-226 | None |
| A0A120MY66 | 2-227 | None |
| A0A2V7V846 | 53-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.