DPCstruct | MC8140
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 65 ± 4 aa |
| Standard deviation of domain lengths | 3.57 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 45.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6MXB3 | 4-63 | IEKNKVTSLETIVRMIGDKPYYEIKYKNLGEDYYHVGYSSFNIKNVLQWKEECFEFVESK |
| A0A373K1B1 | 1-70 | MGKIKVSEIEIIVTGKKEKPYFEIKYREVGKRYYNIGFSSYNLDYVFDWKEKCFEVIKPKKNIFRKVFRI |
| A0A416VUQ8 | 9-74 | None |
| A0A173RE97 | 77-146 | None |
| A0A412SBC6 | 11-71 | None |
| A0A1Y4F380 | 13-78 | None |
| A0A1Y4EZN8 | 13-74 | None |
| A0A3R6PVH6 | 22-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.