DPCstruct | MC814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 423 ± 91 aa |
| Standard deviation of domain lengths | 91.48 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 42.28 |
| Pfam Score | 96.24 |
| Assigned Pfam label(s) | CL0042- CL0105- PF02898 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4BIT9 | 532-834 | FQIPPELVLEVPIRHPKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMNLDMRK… |
| A0A150GQ95 | 5-378 | FELPPQYVARVPIAHPEHPQIAELGLQWYAVPAVSCLELSVGGLTYTACPFNGWYAVTEIVRNITEEGRYDQCPAIASKLGLDTRTD… |
| A0A1S3IG29 | 71-654 | None |
| A0A643C6Y9 | 292-815 | None |
| A0A6P4EAF3 | 1-313 | None |
| F7DLC7 | 295-574 | None |
| S4R9W4 | 167-621 | None |
| A0A6P7GQC6 | 2-494 | None |
| A0A7J7K261 | 2-515 | None |
| A0A158NWJ0 | 2-463 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.