DPCstruct | MC8137
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 56 ± 6 aa |
| Standard deviation of domain lengths | 6.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 39.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J5G3Q9 | 34-76 | DDTEQFAELNGVKAQSVRKRYAQTGSYFGIQPLKLANRRLKWP |
| A0A2N2M4G5 | 2-58 | NNETLNTREFAALVRVDPQTIRRALCVNGHYLGLKPLKLPNHRLLWPGNQARELAGA |
| A0A399WAC8 | 113-170 | None |
| A0A158K726 | 56-118 | None |
| A0A258MAR8 | 4-62 | None |
| A0A5E4RGS5 | 12-70 | None |
| A0A6C2D7U9 | 8-60 | None |
| A0A011N7G8 | 11-68 | None |
| A0A1H5Z438 | 6-73 | None |
| A0A1V5FV76 | 123-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.