DPCstruct | MC8135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 163 ± 10 aa |
| Standard deviation of domain lengths | 10.44 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N2RB56 | 1-143 | MRKWFLLLLFWSGRFDVLDAMRWIAGHTDAEHVYAYIEHEFPGEELPQLEAEYSIDRIYRREQERKINNNVPNSKDGIDALYDIVLK… |
| A0A5K7TZA9 | 2-160 | ELFTDYIEAPVDEYGRRFYPSPHEFRKFFILLMYWHEQNLGFNVASWMAGHTMVQHTQAYTDASINADEISLWEAECIEDKIIELEV… |
| A0A6B8JKC6 | 490-638 | None |
| Q143L5 | 549-720 | None |
| A0A3M5RST4 | 298-460 | None |
| A0A2N1E3A8 | 245-412 | None |
| A0A1I0BJ57 | 386-540 | None |
| A0A4Q7I4G3 | 45-201 | None |
| A0A6N4TX30 | 110-281 | None |
| A0A2S4AMW9 | 175-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.