DPCstruct | MC8133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 129 ± 23 aa |
| Standard deviation of domain lengths | 22.83 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.41 |
| Pfam Score | 68.65 |
| Assigned Pfam label(s) | CL0630- PF08725- CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5JGG9 | 27-156 | SYAEKVNHCLAARANTCSACIQSGKGCAYCPDEIFDEPRCDLLENIIHHGCNGVVTAESSITIERNQKIDMLMKRSQVAPQDMSMTL… |
| E4XGI9 | 14-123 | ISRNVIASSTCQNATITSCEQCMAVDPDCIWCSDPLDESELKKVNKVRCRSRNSPGNCRTFIQPKSDTIYVDPMEQSLMPRKFNITL… |
| A0A6I9Z0L5 | 86-203 | None |
| A0A4W4EFW0 | 5-150 | None |
| A0A3Q4HRR9 | 3-104 | None |
| A0A0C2MM38 | 25-170 | None |
| A0A368F4J9 | 5-121 | None |
| A0A1Y1LG49 | 8-124 | None |
| A0A5B7CKF1 | 76-201 | None |
| A0A1Y1LEL4 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.