DPCstruct | MC813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 191 ± 17 aa |
| Standard deviation of domain lengths | 16.63 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6T8MLU7 | 116-313 | GALVWGSGLWFLSGSRSNPLINPLANLCYNAEYEPWLKDRNEGLFSPVPLPLLLVAITLFFVFGILTEKIVLLLVEGDSILCLQLAG… |
| A0A150GQ49 | 40-251 | ADLLAGLLWGLSLFYASPLQQLLLFLGKIETERPSDWIIMNIARGPLGMNIMDVNEAPSWLTALAAGVCVASGLAISAVLQFGLGNS… |
| B8CED0 | 313-513 | None |
| I0ZAQ7 | 35-236 | None |
| A0A7S1D8X0 | 3-157 | None |
| A0A7S0G172 | 3-179 | None |
| A0A7R9UDG4 | 159-366 | None |
| A0A835XVL2 | 534-726 | None |
| R7QTR7 | 118-285 | None |
| A0A7S3PTL6 | 164-372 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.