DPCstruct | MC8126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 96 ± 8 aa |
| Standard deviation of domain lengths | 8.18 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 48.05 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | CL0122- CL0613 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177T8Z9 | 125-209 | LLWPCAWSITLAAQALALPPAVPLWNLLLFSTGALVMRGAGCTINDMWDVRVDRMVERTSLRPIAAGEVTMFQAWCFLGVQLSAG |
| E4WUQ3 | 227-312 | LLFVPAFMGLVSGCQFTQLPDAYLMSIFAAGTLLTRGAGCTINDIWDHKLDAQVERCKSRPIPSGAVSVEKAKLFFAAQLSAAFGL |
| A0A0D2MWV7 | 914-1005 | None |
| A0A0C2IBU2 | 5-95 | None |
| A0A068UVE3 | 119-211 | None |
| A0A532E6Y1 | 23-121 | None |
| A0A421JHZ6 | 473-578 | None |
| X5P2N5 | 17-111 | None |
| A0A485NP83 | 539-639 | None |
| A0A7C7FTL2 | 9-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.