DPCstruct | MC8125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 93 ± 15 aa |
| Standard deviation of domain lengths | 15.20 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 42.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12166 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B2V010 | 200-281 | GILSLYLSMVLVFGRLMRSIVTGAMQRIMFEELPNVDRVLRLCLDIYLVREAGELQLEEDLFAKLVFLFRSPATLIKWTKEK |
| E4WT51 | 40-121 | GVIGLYLSVVLLAGRYTRAIFQYDGAYIMFHEYPNVDELLQLCSDIYLVRELKEWKLEEDLMAKLIYLYRSPETMLRVTKLR |
| A0A818JW98 | 224-310 | None |
| A0A287KXY7 | 2-103 | None |
| E4Z1J3 | 291-376 | None |
| A0A448XN67 | 2-84 | None |
| A2Q5Z3 | 223-308 | None |
| A0A7F8K7I5 | 575-677 | None |
| A0A820BAS2 | 310-391 | None |
| A0A7S4PQ97 | 334-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.