DPCstruct | MC8124
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 201 ± 25 aa |
| Standard deviation of domain lengths | 24.53 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 66.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05616 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9BV75 | 38-253 | EPKVRESLENTPLPEKLPGIIPLDYPIDLPVINPSPAMQPQPLFVPTGNPVQNPSYDPSAAPGPNNSPYLQPGIRVVPSPAPGAPWQ… |
| O82968 | 1-180 | MSAAKVPIPVKLTPSTTPVNVNLSDPYVDPVTGKRYRDVATVTPNSDGKTATLTTGKQEVDANGNPATDPATGNGKAPEKQDDQCSG… |
| A0A172U9F4 | 1-233 | None |
| L2EE54 | 3-176 | None |
| A0A1A9RQR3 | 317-482 | None |
| A0A2P7U1Q6 | 2-222 | None |
| A0A1A9RRS8 | 190-403 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.